PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13905_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 272aa    MW: 30706.7 Da    PI: 5.379
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13905_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.7e-181663148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd++l+++++q G g+W++ +++ g+ R++k+c++rw +yl
  cra_locus_13905_iso_3_len_896_ver_3 16 KGPWTKEEDDILINYINQNGHGNWRALPKKAGLLRCGKSCRLRWTNYL 63
                                         79******************************99************97 PP

2Myb_DNA-binding50.93.5e-1669114148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg++++eE++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  cra_locus_13905_iso_3_len_896_ver_3  69 RGNFSKEEEDTIIHLHHALGNR-WSAIAARLP-GRTDNEIKNVWHTHL 114
                                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-25766IPR009057Homeodomain-like
PROSITE profilePS5129416.8931163IPR017930Myb domain
SuperFamilySSF466896.11E-3012110IPR009057Homeodomain-like
SMARTSM007171.2E-141565IPR001005SANT/Myb domain
PfamPF002495.9E-161663IPR001005SANT/Myb domain
CDDcd001679.25E-111863No hitNo description
PROSITE profilePS5129425.05964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2667119IPR009057Homeodomain-like
SMARTSM007172.1E-1468116IPR001005SANT/Myb domain
PfamPF002492.4E-1569114IPR001005SANT/Myb domain
CDDcd001671.12E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
XEMGRAPCCE KMGLKKGPWT KEEDDILINY INQNGHGNWR ALPKKAGLLR CGKSCRLRWT  60
NYLRPDIKRG NFSKEEEDTI IHLHHALGNR WSAIAARLPG RTDNEIKNVW HTHLKKKLVK  120
QSAIPDPQIS ETPRPAKLDQ YRHETAGGED SIRSSLSTEM SIHDQSNSPP HSSSSSNDDV  180
SSSNITTSCT SNSNTTENDA EMSCLLLNNL NEDFWLDLDF VSCENSWKFI GGEDVGDYCN  240
SSFIINNSSS ISDDDINFWS DPFPRAEELP QF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-26141185108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012569365.16e-81PREDICTED: myb-related protein Myb4
TrEMBLB9GS151e-80B9GS15_POPTR; GmMYB29 family protein
STRINGPOPTR_0002s03960.13e-80(Populus trichocarpa)